Learn More
CPC Scientific H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 (trifluoroacetate salt) 0.5MG

Supplier: CPC Scientific GLUC017A

GLP-1 (9-36) is a truncated product from the degradation of GLP-1 (7-36) by dipeptidyl peptidase IV (DPP-4). The peptide is an antagonist to the GLP-1 (human) receptor and inhibits hepatic glucose production.ONE-LETTER SEQUENCE: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2MOLECULAR FORMULA: C140H214N36O43MOLECULAR WEIGHT:3089.44STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [ 161748-29-4 ], RESEARCH AREA: DiabetesREFERENCES: Ban, K. et. al. Endocrinol 151, 1520 (2010); John, H. et al. Eur J Med Res 13, 73 (2008); Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008)
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.