Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPC Scientific H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH 1MG
Supplier: CPC Scientific GLUC016B
GLP-1 (7-37) is a insulinotropic peptide generated from by precursor GLP-1 (1-37) after proteolytic cleavage. It is secreted by the L cells of intestinal mucosa after food ingestion.SEQUENCE: H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHONE-LETTER SEQUENCE: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGMOLECULAR FORMULA: C151H228N40O47MOLECULAR WEIGHT: 3355.7STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [106612-94-6]SYNONYMS: Preproglucagon (98-128), Insulinotropin acetate salt, Proglucagon (78-108), Glucagon-Like Peptide 1 (7-37), GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)RESEARCH AREA: DiabetesREFERENCES:A.Wettergren et al., Regul. Peptides, 77, 83 (1998)A.B.Damholt et al., Endocrinology, 140, 4800 (1999)J.M.Conlon, Regul. Peptides, 93 3 (2000)D.J.Drucker, Gut, 50, 428 (2002)D.J.Drucker, Gastroenterology, 122, 531 (2002)SKU(s): GLUC-016A, GLUC-016B
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?