Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Glutamate Dehydrogenase Recombinant Protein Antigen
Shop All Novus Biologicals Products

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutamate Dehydrogenase The Glutamate Dehydrogenase Recombinant Protein Antigen is derived from E. coli. The Glutamate Dehydrogenase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 2746 |
| Protein Length | TFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSIL |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | GLUD1 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4 |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | EC 1.4.1, EC 1.4.1.3, GDH 1, GDH, GDH1, GLUD |
| Gene Symbol | GLUD1 |
| Label Type | Unlabeled |
| Show More |
For Research Use Only.
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?