Novus Biologicals™ GPR177/WLS Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR177/WLS. Source: E.coli Amino Acid Sequence: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD The GPR177/WLS Recombinant Protein Antigen is derived from E. coli. The GPR177/WLS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 79971
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: GPR177/WLS Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: C1orf139, DKFZp686I0788, EVIchromosome 1 open reading frame 139, FLJ23091, G protein-coupled receptor 177, GPR177wls, Integral membrane protein GPR177, MGC131760, MGC14878, MRP, Protein evenness interrupted homolog, protein wntless homolog, Putative NF-ka
• Gene Symbol: WLS
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50800. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.