Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ GSTA1/A2/A3/A4/A5 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579336

Catalog No. PIPA579336


Only null left
Add to Cart

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HCCT tissue, human HCCP tissue, rat liver tissue, rat RH35 whole cell, mouse liver tissue. IHC: mouse liver tissue, rat liver tissue.

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules). In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

GSTA1/A2/A3/A4/A5
Polyclonal
Unconjugated
Gsta4
13-hydroperoxyoctadecadienoate peroxidase; Androst-5-ene-3,17-dione isomerase; GHS transferase; glutathione S-alkyltransferase A1; glutathione S-alkyltransferase A2; glutathione S-alkyltransferase A3; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A2; glutathione S-aralkyltransferase A3; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A1; glutathione S-aryltransferase A2; glutathione S-aryltransferase A3; glutathione S-aryltransferase A4; glutathione S-transferase 2; glutathione S-transferase 5.7; Glutathione S-transferase A1; Glutathione S-transferase A1, N-terminally processed; Glutathione S-transferase A2; glutathione S-transferase A3; glutathione S-transferase A3 subunit; glutathione S-transferase A3-3; Glutathione S-transferase A4; glutathione S-transferase A4-4; Glutathione S-transferase A5; glutathione S-transferase A5-5; glutathione S-transferase alpha 1; glutathione S-transferase alpha 2; glutathione S-transferase alpha 3; glutathione S-transferase alpha 4; glutathione S-transferase alpha 5; glutathione S-transferase alpha-1; Glutathione S-transferase alpha-2; glutathione S-transferase alpha-3; Glutathione S-transferase alpha-4; glutathione S-transferase alpha-5; Glutathione S-transferase GT41A; glutathione S-transferase Ha subunit 1; glutathione S-transferase Ya; glutathione S-transferase Ya subunit; glutathione S-transferase Ya1; glutathione S-transferase Ya-1; Glutathione S-transferase Ya-2; Glutathione S-transferase Ya3; glutathione S-transferase Yc; Glutathione S-transferase Yc-1; glutathione S-transferase Yc1 subunit; Glutathione S-transferase Yc-2; glutathione S-transferase Yc2 subunit; glutathione S-transferase Yk; glutathione S-transferase, alpha 1 (Ya); glutathione S-transferase, alpha 2 (Yc2); glutathione S-transferase, alpha 3; glutathione S-transferase, alpha 4; glutathione transferase; glutathione transferase A4-4; glutathione transferase A5; glutathione transferase YA subunit; Glutathione-S-transferase alpha type (Ya); Glutathione-S-transferase alpha type (Yc2); glutathione-S-transferase, alpha type2; GST 1-1; GST 1a-1a; GST 1b-1b; GST 2-2; GST 5.7; GST 8-8; GST A1-1; GST A2-2; GST A3-3; GST A4-4; GST A5-5; GST AA; GST B; GST class-alpha member 1; GST class-alpha member 2; GST class-alpha member 3; GST class-alpha member 4; GST class-alpha member 5; GST HA subunit 1; GST HA subunit 2; GST K; GST Ya1; GST Ya2; GST Yc1; GST Yc2; GST Yk; GST2; Gst2-1; Gst2-2; Gst2-3; GST5.7; Gsta; Gsta1; GSTA1-1; Gsta2; GSTA2-2; GSTA3; GSTA3-3; GSTA4; GSTA4-4; Gsta5; Gstc2; Gstc-2; GST-epsilon; GST-gamma; Gstya; Gstyc; Gstyc1; Gstyc2; GTA2; GTA3; GTA4; GTH1; GTH2; Ligandin; liver GST2; mGsta4; OTTMUSG00000031890; S-(hydroxyalkyl)glutathione lyase A1; S-(hydroxyalkyl)glutathione lyase A2; S-(hydroxyalkyl)glutathione lyase A3; S-(hydroxyalkyl)glutathione lyase A4; testicular tissue protein Li 80; testis tissue sperm-binding protein Li 59n; Yc1; Yc2
Rabbit
Antigen affinity chromatography
RUO
100042314, 14857, 14858, 14859, 14860, 221357, 24421, 24422, 2938, 2939, 2940, 2941, 300850, 494499, 494500
-20°C
Lyophilized
Immunohistochemistry (Paraffin), Western Blot
500 μg/mL
PBS with 5mg BSA and 0.05mg sodium azide
O15217, P00502, P04903, P04904, P08263, P09210, P10648, P13745, P14942, P24472, P30115, P46418, Q16772, Q7RTV2
GSTA1, GSTA2, Gsta3, Gsta4, Gsta5
A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.