Abnova™ H3F3B Recombinant Protein

Catalog No.	Quantity
89-010-164	10 μg
89-010-165	25 μg

Catalog No. 89-010-164 Supplier Abnova™ Supplier No. H00003021P0110

Description

Human H3F3B full-length ORF ( AAH17558, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is poyadenylated, unlike most histone genes. The protein encoded is a member of the histone H3 family.(provided by RefSeq)

• Molecular weight: 40.70kDa
• Preparation method: in vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer

Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Best when used within three months from the date of receipt

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH17558
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Gene ID (Entrez): 3021
• Molecular Weight (g/mol): 40.7
• Name: H3F3B (Human) Recombinant Protein (P01)
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Source: Wheat Germ (in vitro)
• Immunogen: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: H3.3B/H3F3A
• Common Name: H3F3B
• Gene Symbol: H3F3B
• Cross Reactivity: Human
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Form: Solution