Learn More
Description
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is poyadenylated, unlike most histone genes. The protein encoded is a member of the histone H3 family.(provided by RefSeq)
- Molecular weight: 40.70kDa
- Preparation method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Best when used within three months from the date of receipt
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Specifications
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Molecular Weight (g/mol) | 40.7 |
| Name | Human H3F3B Full-length ORF Recombinant Protein with GST-tag at N-terminal |
| pH Range | 8 |
| Preparation Method | In vitro wheat germ expression system |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Quality Control Testing | 12.5% SDS-PAGE stained with Coomassie Blue |
| Quantity | 25 μg |
| Source | Wheat Germ (in vitro) |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.