Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

H3F3B Recombinant Protein, Abnova

Human H3F3B full-length ORF ( AAH17558, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal

Manufacturer:  Abnova Corporation H00003021P0125

 View more versions of this product

Catalog No. 89-010-165


Add to cart

Description

Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is poyadenylated, unlike most histone genes. The protein encoded is a member of the histone H3 family.(provided by RefSeq)

  • Molecular weight: 40.70kDa
  • Preparation method: in vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer

Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Best when used within three months from the date of receipt

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Human H3F3B Full-length ORF Recombinant Protein with GST-tag at N-terminal
In vitro wheat germ expression system
12.5% SDS-PAGE stained with Coomassie Blue
Wheat Germ (in vitro)
Human
Solution
40.7
8
Glutathione Sepharose 4 Fast Flow
25μg
-80°C
Yes
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit