missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ HAUS3 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP257796PEP

Catalog No. NBP257796PE


Add to cart

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAUS3. Source: E.coli Amino Acid Sequence: IHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIM The HAUS3 Recombinant Protein Antigen is derived from E. coli. The HAUS3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Blocking/Neutralizing, Control
79441
>80% by SDS-PAGE and Coomassie blue staining
E.coli
RUO
HAUS3
Unlabeled
Yes
PBS and 1M Urea, pH 7.4
HAUS3 Recombinant Protein Antigen
100μL
Store at −20°C. Avoid freeze-thaw cycles
C4orf15, dgt3, HAUS3 HAUS augmin-like complex, subunit 3, IT1
Recombinant Protein Antigen
Human
missing translation for 'documents'
missing translation for 'provideContentCorrection'

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

missing translation for 'productTitle'

For research use only.