Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89947130

Abnova™ HBsAg (ayw) (CAA05872) Full-length Recombinant Protein expressed in yeast

Catalog No. 89947130 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-947-130 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-947-130 Supplier Abnova™ Supplier No. P4875
Add to Cart
Add to Cart

Description

Used for SDS-PAGE

Sequence: MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMTPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI

Specifications

Accession Number CAA05872
For Use With (Application) SDS-PAGE
Formulation Liquid
Molecular Weight (g/mol) 24kDa
Name HBsAg (ayw) Recombinant Protein
Preparation Method Yeast expression system
Quantity 50 μg
Immunogen MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMTPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
Storage Requirements Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Common Name HBSAG
Species Yeast
Recombinant Recombinant
Protein Tag None
Expression System Yeast expression system
Form Liquid
Purity or Quality Grade >98% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.