Novus Biologicals™ UBE2K/E2-25K Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Supplier:  Novus Biologicals™ NBP191987PEP

Catalog No. NBP191987PE

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBE2K. The UBE2K/E2-25K Recombinant Protein Antigen is derived from E. coli. The UBE2K/E2-25K Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 3093
• Purification Method: Chromatography
• Common Name: UBE2K/E2-25K
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: UBE2K
• Molecular Weight (g/mol): 30kDa
• Quantity: 0.1mL
• Source: E.Coli
• Immunogen: VTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATEL

• Species: Human
• Purity: >80%
• Concentration: 0.5mg/mL
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: E2(25K), E2-25K, EC 6.3.2.19, HIP-2, huntingtin interacting protein 2, Huntingtin-interacting protein 2, HYPG, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 K, Ubiquitin-conjugating enzyme E2(25K), Ubiquitin-conjugating enzyme E2-25 kDa, Ubiquitin-conjugating enzyme E2-25K, ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast), ubiquitin-protein ligase
• Label Type: Unlabeled
• Product Type: HIP2
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91987. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Safety and Handling

ShelfLife : 365

For Research Use Only