Invitrogen™ hnRNP A1 Polyclonal Antibody

Catalog No.	Quantity
PIPA579381	100 μg

Catalog No. PIPA579381 Supplier Invitrogen™ Supplier No. PA579381

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human Daudi whole cell, human MOLT-4 whole cell, human HL-60 whole cell. IHC: mouse intestine tissue, mouse kidney tissue, rat kidney tissue, human intestinal cancer tissue, human placenta tissue. ICC/IF: U20S cell, A431 cell. Flow: K562 cell.

HnRNP A1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre mRNAs in the nucleus and appear to influence pre mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. hnRNP A1 has two repeats of quasi RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re imported.

Specifications

• Antigen: hnRNP A1
• Applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: Hnrnpa1
• Gene Accession No.: P04256, P09651, P49312
• Gene Alias: ALS19; ALS20; Fli-2; Hdp; HDP-1; Helix-destabilizing protein; heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP A1-like 3; hnRNP core protein A1; hnRNP core protein A1-like 3; hnRNP I; Hnrnpa1; hnRNP-A1; HNRNPI; HNRNP-I; Hnrpa1; HNRPA1L3; HNRPA1MGC102835; HNRPI; I79_022927; IBMPFD3; MGC102835; MGC128297 protein; nuclear ribonucleoprotein particle A1 protein; pPTB; PTB; PTB-1; PTB2; PTB3; PTB4; PTB-T; putative heterogeneous nuclear ribonucleoprotein A1-like 3; Putative heterogeneous nuclear ribonucleoprotein A1-like protein 3; ROA1; RP11-78J21.1; single-strand DNA-binding protein UP1; single-strand RNA-binding protein; Single-strand-binding protein; Tis; Topoisomerase-inhibitor suppressed; unwinding protein 1; UP 1; UP1
• Gene Symbols: Hnrnpa1
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 15382, 29578, 3178
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov