Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ hnRNP A1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579381
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579381 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579381 Supplier Invitrogen™ Supplier No. PA579381
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human Daudi whole cell, human MOLT-4 whole cell, human HL-60 whole cell. IHC: mouse intestine tissue, mouse kidney tissue, rat kidney tissue, human intestinal cancer tissue, human placenta tissue. ICC/IF: U20S cell, A431 cell. Flow: K562 cell.

HnRNP A1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre mRNAs in the nucleus and appear to influence pre mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. hnRNP A1 has two repeats of quasi RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re imported.
TRUSTED_SUSTAINABILITY

Specifications

Antigen hnRNP A1
Applications Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Hnrnpa1
Gene Accession No. P04256, P09651, P49312
Gene Alias ALS19; ALS20; Fli-2; Hdp; HDP-1; Helix-destabilizing protein; heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP A1-like 3; hnRNP core protein A1; hnRNP core protein A1-like 3; hnRNP I; Hnrnpa1; hnRNP-A1; HNRNPI; HNRNP-I; Hnrpa1; HNRPA1L3; HNRPA1MGC102835; HNRPI; I79_022927; IBMPFD3; MGC102835; MGC128297 protein; nuclear ribonucleoprotein particle A1 protein; pPTB; PTB; PTB-1; PTB2; PTB3; PTB4; PTB-T; putative heterogeneous nuclear ribonucleoprotein A1-like 3; Putative heterogeneous nuclear ribonucleoprotein A1-like protein 3; ROA1; RP11-78J21.1; single-strand DNA-binding protein UP1; single-strand RNA-binding protein; Single-strand-binding protein; Tis; Topoisomerase-inhibitor suppressed; unwinding protein 1; UP 1; UP1
Gene Symbols Hnrnpa1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 15382, 29578, 3178
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.