Abnova™ Human ABO (NP_065202, 54 a.a. - 354 a.a. ) Full-length Recombinant Protein with His tag

Catalog No.	Quantity
89-932-236	50 μg

Catalog No. 89-932-236 Supplier Abnova™ Supplier No. P3941

Description

Used for SDS-PAGE

This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

Specifications

• Accession Number: NP_065202
• Concentration: 0.5 mg/mL
• For Use With (Application): SDS-PAGE
• Formulation: In 20mM Tris-HCl, 200mM NaCl, pH 8.0 (2mM dithiothreitol, 20% glycerol)
• Gene ID (Entrez): 28
• Molecular Weight (g/mol): 37.4kDa
• Name: ABO (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS PAGE.
• Quantity: 50 μg
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: A3GALNT/A3GALT1/GTB/NAGAT
• Common Name: ABO
• Gene Symbol: ABO
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: His
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >85% by SDS-PAGE