Abnova™ Human ACSL1 Partial ORF (NP_001986, 48 a.a. - 145 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-932-396	10 ug
89-932-397	25 ug

Catalog No. 89-932-396 Supplier Abnova™ Supplier No. H00002180Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. [provided by RefSeq]

Sequence: PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA

Specifications

• Accession Number: NP_001986
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 2180
• Molecular Weight (g/mol): 36.52kDa
• Name: ACSL1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ACS1/FACL1/FACL2/LACS/LACS1/LACS2
• Common Name: ACSL1
• Gene Symbol: ACSL1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid