Abnova™ Human ACVR1C Partial ORF (AAH22530.1, 23 a.a. - 112 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-932-496	10 μg
89-932-497	25 μg

Catalog No. 89-932-496 Supplier Abnova™ Supplier No. H00130399Q01S

Description

Used for AP, Array, ELISA, WB-Re

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM]

Sequence: SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM

Specifications

• Accession Number: AAH22530.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 130399
• Molecular Weight (g/mol): 35.53kDa
• Name: ACVR1C (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ACVRLK7/ALK7
• Common Name: ACVR1C
• Gene Symbol: ACVR1C
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid