Abnova™ Human ADAM11 Partial ORF (NP_002381, 230 a.a. - 333 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-932-532	10μg
89-932-533	25μg

Catalog No. 89-932-532 Supplier Abnova™ Supplier No. H00004185Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene represents a candidate tumor supressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. [provided by RefSeq]

Sequence: GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR

Specifications

• Accession Number: NP_002381
• For Use With (Application): Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 4185
• Molecular Weight (g/mol): 37.18kDa
• Name: Human ADAM11 Partial ORF (NP_002381, 230 a.a. - 333 a.a.) Recombinant Protein with GST-tag at N-terminal
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10μg
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MDC
• Common Name: ADAM11
• Gene Symbol: ADAM11
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST Tag
• Expression System: wheat germ expression system
• Form: Liquid