Abnova™ Human ADARB1 Partial ORF (AAH65545, 592 a.a. - 701 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-932-626	25 μg
89-932-625	10 μg

Catalog No. 89-932-626 Supplier Abnova™ Supplier No. H00000104Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq]

Sequence: PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP

Specifications

• Accession Number: AAH65545
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 104
• Molecular Weight (g/mol): 37.84kDa
• Name: ADARB1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ADAR2/ADAR2a/ADAR2a-L1/ADAR2a-L2/ADAR2a-L3/ADAR2b/ADAR2c/ADAR2d/ADAR2g/DRABA2/DRADA2/RED1
• Common Name: ADARB1
• Gene Symbol: ADARB1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid