Abnova™ Human ADCY2 Partial ORF (NP_065433, 977 a.a. - 1086 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-932-643	10 μg
89-932-644	25 μg

Catalog No. 89-932-643 Supplier Abnova™ Supplier No. H00000108Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq]

Sequence: GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS

Specifications

• Accession Number: NP_065433
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 108
• Molecular Weight (g/mol): 37.84kDa
• Name: ADCY2 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: AC2/FLJ16822/FLJ45092/HBAC2/KIAA1060/MGC133314
• Common Name: ADCY2
• Gene Symbol: ADCY2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid