Abnova™ Human ADIPOR1 Partial ORF (NP_057083.2, 72 a.a. - 136 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-932-717	10 μg
89-932-718	25 μg

Catalog No. 89-932-717 Supplier Abnova™ Supplier No. H00051094Q01S

Description

Used for AP, Array, ELISA, WB-Re

The adiponectin receptors, ADIPOR1 and ADIPOR2 (MIM 607946), serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM]

Sequence: QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG

Specifications

• Accession Number: NP_057083.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 51094
• Molecular Weight (g/mol): 32.89kDa
• Name: ADIPOR1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ACDCR1/CGI-45/CGI45/FLJ25385/FLJ42464/PAQR1/TESBP1A
• Common Name: ADIPOR1
• Gene Symbol: ADIPOR1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid