Learn More
Abnova™ Human Adora2B Full-Length Orf (Abm82640.1) Recombinant Protein Without Tag.
Shop All Abnova Corporation ProductsDescription
Immunogen Sequence: MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYI
Specifications
Specifications
| Accession Number | ABM82640.1 |
| For Use With (Application) | Antibody Production, Compound Screening, Functional Study |
| Formulation | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene ID (Entrez) | 136 |
| Name | ADORA2B (Human) Recombinant Protein |
| Quantity | 2 ug |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Regulatory Status | RUO |
| Gene Alias | ADORA2 |
| Common Name | ADORA2B |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.