Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human Adora2B Full-Length Orf (Abm82640.1) Recombinant Protein Without Tag.

Catalog No. 89032177 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
2 ug
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-032-177 2 ug
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-032-177 Supplier Abnova™ Supplier No. H00000136G01
Add to Cart
Add to Cart

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Good Folding

Immunogen Sequence: MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYI

Specifications

Accession Number ABM82640.1
For Use With (Application) Antibody Production, Compound Screening, Functional Study
Formulation 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID (Entrez) 136
Name ADORA2B (Human) Recombinant Protein
Quantity 2 ug
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ADORA2
Common Name ADORA2B
Gene Symbol ADORA2B
Species Wheat Germ (in vitro)
Protein Tag None
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.