Abnova™ Human AKR1C3 (NP_003730, 1 a.a. - 323 a.a.) Full-length Recombinant Protein with His tag

Catalog No.	Quantity
89-933-022	100 μg

Catalog No. 89-933-022 Supplier Abnova™ Supplier No. P3481

Description

Used for Func, SDS-PAGE

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

Specifications

• Accession Number: NP_003730
• Concentration: 1 mg/mL
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: In 20mM Tris-HCl, pH 8.0 (10% glycerol)
• Gene ID (Entrez): 8644
• Molecular Weight (g/mol): 39kDa
• Name: AKR1C3 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Quantity: 100 μg
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <1.0 EU/μg of protein (determined by LAL method)
• Gene Alias: DD3/DDX/HA1753/HAKRB/HAKRe/HSD17B5/KIAA0119/hluPGFS
• Common Name: AKR1C3
• Gene Symbol: AKR1C3
• Biological Activity: Specific activity: approximately > 0.1 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1μmole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: His
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >95% by SDS-PAGE