Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human AKR7A3 (AAH25709, 1 a.a. - 331 a.a.) Full-length Recombinant Protein with His tag

Catalog No. 89933038 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-933-038 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-933-038 Supplier Abnova™ Supplier No. P3497
Add to Cart
Add to Cart

Used for Func, SDS-PAGE

Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]

Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPNYFR

Specifications

Accession Number AAH25709
Concentration 0.5 mg/mL
For Use With (Application) Functional Study, SDS-PAGE
Formulation In 20mM Tris-HCl, 100mM NaCl, pH 8.0 (10% glycerol)
Gene ID (Entrez) 22977
Molecular Weight (g/mol) 41.6kDa
Name AKR7A3 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing Loading 3 ug protein in 15% SDS-PAGE
Quantity 50 μg
Storage Requirements Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias AFAR2
Common Name AKR7A3
Gene Symbol AKR7A3
Biological Activity Specific activity: approximately < 0.1 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1μmole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
Species E. coli
Recombinant Recombinant
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.