Abnova™ Human AMACR Full-length ORF (AAH09471, 1 a.a. - 198 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-933-278	2 μg

Catalog No. 89-933-278 Supplier Abnova™ Supplier No. H00023600P01

Description

Used for AP, Array, ELISA, WB-Re

Alpha-methylacyl-CoA racemase is responsible for the conversion of pristanoyl-CoA and C27-bile acyl-CoAs to their (S)-stereoisomers, which are the only stereoisomers that can be degraded via peroxisomal beta-oxidation.[supplied by OMIM]

Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV

Specifications

• Accession Number: AAH09471
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 23600
• Molecular Weight (g/mol): 47.52kDa
• Name: AMACR (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 2 μg
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: RACE
• Common Name: AMACR
• Gene Symbol: AMACR
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid