Abnova™ Human APOL4 Full-length ORF (ENSP00000331089, 1 a.a. - 107 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-935-378	25 μg
89-935-377	10 μg

Catalog No. 89-935-378 Supplier Abnova™ Supplier No. H00080832P01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. [provided by RefSeq]

Sequence: MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV

Specifications

• Accession Number: ENSP00000331089
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 80832
• Molecular Weight (g/mol): 37.7kDa
• Name: APOL4 (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: APOL-IV/APOLIV
• Common Name: APOL4
• Gene Symbol: APOL4
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid