Abnova™ Human ARHGEF12 Partial ORF (NP_056128, 817 a.a. - 916 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-935-534	25 μg
89-935-533	10 μg

Catalog No. 89-935-534 Supplier Abnova™ Supplier No. H00023365Q01L

Description

Used for AP, Array, ELISA, WB-Re

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. This protein is observed to form myeloid/lymphoid fusion partner in acute myeloid leukemia. [provided by RefSeq]

Sequence: VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAE

Specifications

• Accession Number: NP_056128
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 23365
• Molecular Weight (g/mol): 36.74kDa
• Name: ARHGEF12 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAE
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DKFZp686O2372/KIAA0382/LARG/PRO2792
• Common Name: ARHGEF12
• Gene Symbol: ARHGEF12
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid