Abnova™ Human BATF Full-length ORF (NP_006390.1, 1 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-936-416	10 μg
89-936-417	25 μg

Catalog No. 89-936-416 Supplier Abnova™ Supplier No. H00010538P01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. [provided by RefSeq]

Sequence: MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP

Specifications

• Accession Number: NP_006390.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 10538
• Molecular Weight (g/mol): 40.5kDa
• Name: BATF (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: B-ATF/BATF1/SFA-2/SFA2
• Common Name: BATF
• Gene Symbol: BATF
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid