Learn More
Description
The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq]
Specifications
Specifications
| Accession Number | P23560 |
| For Use With (Application) | Functional Study, SDS-PAGE |
| Formulation | Lyophilized |
| Gene ID (Entrez) | 627 |
| Molecular Weight (g/mol) | 27kDa |
| Name | BDNF (Human) Recombinant Protein |
| Preparation Method | Escherichia coli expression system |
| Quality Control Testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quantity | 10 μg |
| Immunogen | MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.