Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89936750

Abnova™ Human BMP4 (P12644) Partial Recombinant Protein expressed in HeLa cells

Catalog No. 89936750 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
5 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-936-750 5 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-936-750 Supplier Abnova™ Supplier No. P5949

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein. [provided by RefSeq]

Sequence: HHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Specifications

Accession Number P12644
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 652
Molecular Weight (g/mol) 31-36kDa
Name BMP4 (Human) Recombinant Protein
Preparation Method Mammalian cell (HeLa) expression system
Quantity 5 μg
Immunogen HHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Storage Requirements Store at -20°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg of protein (<1 EU/μg).
Gene Alias BMP2B/BMP2B1/MCOPS6/ZYME
Common Name BMP4
Gene Symbol BMP4
Assays Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Biological Activity Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells.
Cross Reactivity Human ;Human
Species Human
Recombinant Recombinant
Protein Tag None
Expression System Mammalian cell (HeLa) expression system
Form Lyophilized
Purity or Quality Grade 0.97
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.