Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human BNIP1 Full-length ORF (AAH10959, 1 a.a. - 228 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89936803 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 ug
25μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-936-803 25μg
89-936-802 10 ug
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-936-803 Supplier Abnova™ Supplier No. H00000662P01L
Add to Cart
Add to Cart

Used for AP, Array, ELISA, WB-Re

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq]

Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL

Specifications

Accession Number AAH10959
For Use With (Application) Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 662
Molecular Weight (g/mol) 50.82kDa
Name Human BNIP1 Full-length ORF (AAH10959, 1 a.a. - 228 a.a.) Recombinant Protein with GST-tag at N-terminal
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25μg
Storage Requirements Store at −80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias NIP1, SEC20, TRG-8
Common Name BNIP1
Gene Symbol BNIP1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST Tag
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.