Abnova™ Human CAPZB Full-length ORF (AAH08095.1, 1 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-938-001	2 μg

Catalog No. 89-938-001 Supplier Abnova™ Supplier No. H00000832P01

Description

Used for AP, Array, ELISA, WB-Re

CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq]

Sequence: MLNLCFMLTRHAVHSLDSFLRKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFCHTSLSVLSTFP

Specifications

• Accession Number: AAH08095.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 832
• Molecular Weight (g/mol): 35.1kDa
• Name: CAPZB (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 2 μg
• Immunogen: MLNLCFMLTRHAVHSLDSFLRKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFCHTSLSVLSTFP
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CAPB/CAPPB/CAPZ/MGC104401/MGC129749/MGC129750
• Common Name: CAPZB
• Gene Symbol: CAPZB
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid