Abnova™ Human CCL14 (Q16627, 22 a.a. - 93 a.a.) Partial Recombinant Protein

Catalog No.	Quantity
89-938-350	10 μg

Catalog No. 89-938-350 Supplier Abnova™ Supplier No. P3618

Description

Used for Func, SDS-PAGE

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene CCL15, and are represented as GeneID: 348249. [provided by RefSeq]

Sequence: KTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Specifications

• Accession Number: Q16627
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 6358
• Molecular Weight (g/mol): 9kDa
• Name: CCL14 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 10 μg
• Immunogen: KTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Gene Alias: CC-1/CC-3/CKb1/HCC-1/HCC-3/MCIF/NCC-2/NCC2/SCYA14/SCYL2/SY14
• Common Name: CCL14
• Gene Symbol: CCL14
• Biological Activity: Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC