Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89938355

Abnova™ Human CCL15 (Q16663, 22 a.a. - 113 a.a.) Partial Recombinant Protein

Catalog No. 89938355 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-938-355 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-938-355 Supplier Abnova™ Supplier No. P3619
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq]

Sequence: QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Specifications

Accession Number Q16663
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 6359
Molecular Weight (g/mol) 10kDa
Name CCL15 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 25 μg
Immunogen QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1 EU/μg)
Gene Alias HCC-2/HMRP-2B/LKN1/Lkn-1/MIP-1d/MIP-5/NCC-3/NCC3/SCYA15/SCYL3/SY15
Common Name CCL15
Gene Symbol CCL15
Biological Activity Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.