Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89938361

Abnova™ Human CCL16 (O15467, 24 a.a. - 120 a.a.) Partial Recombinant Protein

Catalog No. 89938361 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-938-361 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-938-361 Supplier Abnova™ Supplier No. P3620
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq]

Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Specifications

Accession Number O15467
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 6360
Molecular Weight (g/mol) 11kDa
Name CCL16 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 25 μg
Immunogen QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1 EU/μg)
Gene Alias CKb12/HCC-4/ILINCK/LCC-1/LEC/LMC/MGC117051/Mtn-1/NCC-4/NCC4/SCYA16/SCYL4
Common Name CCL16
Gene Symbol CCL16
Biological Activity Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.