Abnova™ Human CCL19 (P55774) Recombinant Protein

Catalog No.	Quantity
89-938-372	20 μg

Catalog No. 89-938-372 Supplier Abnova™ Supplier No. P4430

Description

Used for Func, SDS-PAGE

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq]

Sequence: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Specifications

• Accession Number: P55774
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 6363
• Molecular Weight (g/mol): 8.8kDa
• Name: CCL19 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Quantity: 20 μg
• Immunogen: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: CKb11/ELC/MGC34433/MIP-3b/MIP3B/SCYA19
• Common Name: CCL19
• Gene Symbol: CCL19
• Biological Activity: The activity is determined by the ability to chemoattract human T cells and is detectable starting at 5ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized