Abnova™ Human CCL21 (O00585, 1 a.a. - 134 a.a.) Full-length Recombinant Protein

Catalog No.	Quantity
89-938-386	20 μg

Catalog No. 89-938-386 Supplier Abnova™ Supplier No. P3606

Description

Used for Func, SDS-PAGE

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq]

Sequence: MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Specifications

• Accession Number: O00585
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 6366
• Molecular Weight (g/mol): 12kDa
• Name: CCL21 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 20 μg
• Immunogen: MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Gene Alias: 6Ckine/CKb9/ECL/MGC34555/SCYA21/SLC/TCA4
• Common Name: CCL21
• Gene Symbol: CCL21
• Biological Activity: Determined by its ability to chemoattract total lymphocyte population using a concentration range of 10.0-100.0ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC