Abnova™ Human CCL28 (NP_683513, 23 a.a. - 127 a.a.) Partial Recombinant Protein with His tag

Catalog No.	Quantity
89-938-415	100 μg

Catalog No. 89-938-415 Supplier Abnova™ Supplier No. P3542

Description

Used for SDS-PAGE

This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Specifications

• Accession Number: NP_683513
• Concentration: 1 mg/mL
• For Use With (Application): SDS-PAGE
• Formulation: Liquid
• Gene ID (Entrez): 56477
• Molecular Weight (g/mol): 14.3kDa
• Name: CCL28 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Quantity: 100 μg
• Immunogen: MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <1.0 EU/μg of protein (determined by LAL method )
• Gene Alias: CCK1/MEC/MGC71902/SCYA28
• Common Name: CCL28
• Gene Symbol: CCL28
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: His
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >90% by SDS-PAGE