Learn More
Abnova™ Human CECR1 Full-length ORF (NP_803124.1, 1 a.a. - 270 a.a.) Recombinant Protein with GST-tag at N-terminal
Shop All Abnova Corporation ProductsDescription
This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein may act as a growth factor and have adenosine deaminase activity. It may be responsible for some of the phenotypic features associated with cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Specifications
Specifications
| Accession Number | NP_803124.1 |
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 51816 |
| Molecular Weight (g/mol) | 57.1kDa |
| Name | CECR1 (Human) Recombinant Protein (P01) |
| Purification Method | Glutathione Sepharose 4 Fast Flow |
| Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quantity | 25 μg |
| Immunogen | MDSLEWNWALVYELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.