Invitrogen™ Human Chromogranin A (aa 22-162) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96603	100 μL

Catalog No. RP96603 Supplier Invitrogen™ Supplier No. RP96603

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110826 (PA5-110826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Chromogranin A (CHGA) is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocine cells. CHGA is a precursor to three biologically active peptides: vasostatin, pancreastatin, and parastatin. These peptides act as autocine or paracrine negative modulators of the neuroendocrine system. CHGA is an excellent marker for carcinoid tumors, pheo-chromocytomas, paragangliomas, and other neuro-endocrine tumors. Coexpression of chromogranin A and neuron specific enolase (NSE) is common in neuroendocrine neoplasms.

Specifications

• Accession Number: P10645
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1113
• Name: Human Chromogranin A (aa 22-162) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL-11; AL26; Beta-granin; betagranin (N-terminal fragment of chromogranin A); catestatin; CgA; CHGA; ChrA; chromofungin; chromogranin A; chromogranin A (parathyroid secretory protein 1); chromogranin A precursor; chromogranin-A; CTNNB; DKFZp686D02253; EA-92; ER-37; ES-43; FLJ25606; FLJ37923; GE-25; GR-44; GV-19; LF-19; LOW QUALITY PROTEIN: chromogranin-A; MGC105435; Pancreastatin; Parastatin; parathyroid secretory protein 1; p-Glu serpinin precursor; pituitary secretory protein I; Serpinin; Serpinin-RRG; SL21; SP-I; SS-18; Vasostatin I; Vasostatin II; Vasostatin-1; Vasostatin-2; WA-8; WE-14
• Common Name: Chromogranin A
• Gene Symbol: Chga
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining