Abnova™ Human CRCP (NP_055293, 1 a.a. - 148 a.a. ) Full-length Recombinant Protein with His tag

Catalog No.	Quantity
89-940-443	100 μg

Catalog No. 89-940-443 Supplier Abnova™ Supplier No. P3945

Description

Used for SDS-PAGE

This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Specifications

• Accession Number: NP_055293
• Concentration: 0.5 mg/mL
• For Use With (Application): SDS-PAGE
• Formulation: Liquid
• Gene ID (Entrez): 27297
• Molecular Weight (g/mol): 19.0kDa
• Name: CRCP (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS PAGE.
• Quantity: 100 μg
• Immunogen: MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CGRP-RCP/MGC111194/RCP/RCP9
• Common Name: CRCP
• Gene Symbol: CRCP
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: His
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >95% by SDS-PAGE