Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CRYAA Full-length ORF (NP_000385.1, 1 a.a. - 173 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00001409P01S

 View more versions of this product

Catalog No. 89-940-614


Add to cart

Description

Description

Crystallins are separated into 2 classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes major pr. of vertebrate eye lens and maintains transparency and refractive index of lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into a, b, and g families; b and g crystallins are considered as a superfamily. a and b families are further divided into acidic and basic groups. 7 protein regions exist in crystallins: 4 homologous motifs, a connecting peptide, and N- and C-terminal extensions. a crystallins are composed of 2 gene products: a-A and a-B, for acidic and basic, respectively. a crystallins can be induced by heat shock and are members of the sHSP (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in fashion of a true chaperone instead they hold them in large soluble aggregates. Post-translational modifications decrease ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the a-A and a-B subunits have a 3:1 ratio, resp. Two additional functions of a crystallins are an autokinase activity and participation in intracellular architecture. a-A and a-B gene products are differentially expressed a-A is preferentially restricted to lens and a-B is expressed widely in many tissues and organs. Defects in this gene cause ADCC.

Sequence: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Specifications

Specifications

NP_000385.1
Liquid
1409
CRYAA (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
RUO
CRYAA
wheat germ expression system
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.3kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CRYA1|HSPB4
CRYAA
Wheat Germ (in vitro)
GST
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit