Abnova™ Human CRYAA Full-length ORF (NP_000385.1, 1 a.a. - 173 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-940-614	10 ug
89-940-615	25 ug

Catalog No. 89-940-614 Supplier Abnova™ Supplier No. H00001409P01S

Description

Used for AP, Array, ELISA, WB-Re

Crystallins are separated into 2 classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes major pr. of vertebrate eye lens and maintains transparency and refractive index of lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into a, b, and g families; b and g crystallins are considered as a superfamily. a and b families are further divided into acidic and basic groups. 7 protein regions exist in crystallins: 4 homologous motifs, a connecting peptide, and N- and C-terminal extensions. a crystallins are composed of 2 gene products: a-A and a-B, for acidic and basic, respectively. a crystallins can be induced by heat shock and are members of the sHSP (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in fashion of a true chaperone instead they hold them in large soluble aggregates. Post-translational modifications decrease ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the a-A and a-B subunits have a 3:1 ratio, resp. Two additional functions of a crystallins are an autokinase activity and participation in intracellular architecture. a-A and a-B gene products are differentially expressed a-A is preferentially restricted to lens and a-B is expressed widely in many tissues and organs. Defects in this gene cause ADCC.

Sequence: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Specifications

• Accession Number: NP_000385.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 1409
• Molecular Weight (g/mol): 46.3kDa
• Name: CRYAA (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CRYA1/HSPB4
• Common Name: CRYAA
• Gene Symbol: CRYAA
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid