Abnova™ Human CSF1 (P09603) Recombinant Protein

Catalog No.	Quantity
89-940-686	10 μg

Catalog No. 89-940-686 Supplier Abnova™ Supplier No. P4421

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Specifications

• Accession Number: P09603
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 1435
• Molecular Weight (g/mol): 36.8kDa
• Name: CSF1 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Quantity: 10 μg
• Immunogen: MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: MCSF/MGC31930
• Common Name: CSF1
• Gene Symbol: CSF1
• Biological Activity: The activity is determined by the dose-dependent proliferation of mouse NFS-60 cells. The expected ED50 for this effect is 1.4-2.1ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized