Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CUTA (NP_001014840, 33 a.a. - 179 a.a.) Partial Recombinant Protein with His tag

Used for SDS-PAGE

Manufacturer:  Abnova™ P3404

Catalog No. 89-941-000


Add to cart

Description

Description

Sequence: MRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
Specifications

Specifications

NP_001014840
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
17.1kDa
Escherichia coli expression system
>95% by SDS-PAGE
100 ug
Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
ACHAP|C6orf82|MGC111154
CUTA
Escherichia coli
His
1 mg/mL
Liquid
51596
CUTA (Human) Recombinant Protein
Conventional Chromatography
Loading 3 ug protein in 15% SDS-PAGE
MRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
RUO
CUTA
Escherichia coli expression system
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit