Abnova™ Human CUTL1 Partial ORF (NP_001904.2, 521 a.a. - 620 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-941-005	10 ug
89-941-006	25 ug

Catalog No. 89-941-005 Supplier Abnova™ Supplier No. H00001523Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Sequence: AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI

Specifications

• Accession Number: NP_001904.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 1523
• Molecular Weight (g/mol): 36.63kDa
• Name: CUTL1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CASP/CDP/CDP/Cut/CDP1/COY1/CUTL1/CUX/Clox/Cux/CDP/GOLIM6/Nbla10317/p100/p110/p200/p75
• Common Name: CUX1
• Gene Symbol: CUX1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid