Abnova™ Human CXCL1 (P09341, 35 a.a. - 107 a.a.) Partial Recombinant Protein

Catalog No.	Quantity
89-941-031	25 μg

Catalog No. 89-941-031 Supplier Abnova™ Supplier No. P3615

Description

Used for Func, SDS-PAGE

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif. ELR types are chemotactic for neutrophils, while non-ELR types are chemotactic for lymphocytes.[supplied by OMIM]

Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Specifications

• Accession Number: P09341
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 2919
• Molecular Weight (g/mol): 8kDa
• Name: CXCL1 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 25 μg
• Immunogen: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Gene Alias: FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1
• Common Name: CXCL1
• Gene Symbol: CXCL1
• Biological Activity: Determined by the ability to chemoattract human neutrophils using a concentration range of 10.0-50.0ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC