Abnova™ Human CYP7A1 Partial ORF (NP_000771.2, 179 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-941-288	10 ug
89-941-289	25 ug

Catalog No. 89-941-288 Supplier Abnova™ Supplier No. H00001581Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. [provided by RefSeq]

Sequence: MFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAK

Specifications

• Accession Number: NP_000771.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 1581
• Molecular Weight (g/mol): 36.63kDa
• Name: CYP7A1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Quantity: 10 ug
• Immunogen: MFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAK
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CP7A/CYP7/MGC126826/MGC138389
• Common Name: CYP7A1
• Gene Symbol: CYP7A1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid