Abnova™ Human DARC Full-length ORF (NP_002027.2) Recombinant Protein without tag

Catalog No.	Quantity
89-941-425	2 μg

Catalog No. 89-941-425 Supplier Abnova™ Supplier No. H00002532G01

Description

Used for AP, Func, Screening

The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Specifications

• Accession Number: NP_002027.2
• For Use With (Application): Antibody Production, Compound Screening, Functional Study
• Formulation: Liquid
• Gene ID (Entrez): 2532
• Molecular Weight (g/mol): 35.6kDa
• Name: DARC (Human) Recombinant Protein
• Quantity: 2 μg
• Immunogen: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CCBP1/CD234/Dfy/FY/GPD/GpFy/WBCQ1
• Common Name: DARC
• Gene Symbol: DARC
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: wheat germ expression system with proprietary liposome technology
• Form: Liquid