Abnova™ Human DEFB1 (P60022, 33 a.a. - 70 a.a.) Partial Recombinant Protein

Description

Used for Func, SDS-PAGE

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq]

Sequence: RSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Specifications

• Accession Number: P60022
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 1672
• Molecular Weight (g/mol): 5kDa
• Name: DEFB1 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 20 μg
• Immunogen: RSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Gene Alias: BD1/DEFB-1/DEFB101/HBD1/MGC51822
• Common Name: DEFB1
• Gene Symbol: DEFB1
• Biological Activity: The ED50 was determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 0.1-1.0μg/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC