Learn More
Abnova™ Human DEFB1 (P60022, 33 a.a. - 70 a.a.) Partial Recombinant Protein
Shop All Abnova Corporation ProductsDescription
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq]
Specifications
Specifications
| Accession Number | P60022 |
| For Use With (Application) | Functional Study, SDS-PAGE |
| Formulation | Lyophilized |
| Gene ID (Entrez) | 1672 |
| Molecular Weight (g/mol) | 5kDa |
| Name | DEFB1 (Human) Recombinant Protein |
| Preparation Method | Escherichia coli expression system |
| Purification Method | Ion exchange column and HPLC reverse phase column |
| Quantity | 20 μg |
| Immunogen | RSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.