Abnova™ Human DYNLT1 (NP_006510, 1 a.a. - 113 a.a.) Full-length Recombinant Protein with His tag

Used for SDS-PAGE

Supplier:  Abnova™ P3433

Catalog No. 89-942-627

Description

Cytoplasmic dynein is the major motor protein complex responsible for minus-end, microtubule-based motile processes. Each dynein complex consists of 2 heavy chains that have ATPase and motor activities, plus a group of accessory polypeptides. TCTEX1 is a dynein light chain involved in cargo binding (Chuang et al., 2005 [PubMed 15992542]).[supplied by OMIM]

Sequence: MGSSHHHHHHSSGLVPRGSHMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

Specifications

• Accession Number: NP_006510
• For Use With (Application): SDS-PAGE
• Gene ID (Entrez): 6993
• Name: DYNLT1 (Human) Recombinant Protein
• Purification Method: Conventional Chromatography
• Quantity: 100 ug
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CW-1/MGC111571/TCTEL1/tctex-1
• Gene Symbol: DYNLT1
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >95% by SDS-PAGE

• Concentration: 1 mg/mL
• Formulation: Liquid
• Molecular Weight (g/mol): 14.6kDa
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Immunogen: MGSSHHHHHHSSGLVPRGSHMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
• Regulatory Status: RUO
• Common Name: DYNLT1
• Species: E. coli
• Protein Tag: His
• Form: Liquid