Abnova™ Human EGF Partial ORF (NP_001954, 926 a.a. - 1025 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-942-891	10 ug
89-942-892	25 ug

Catalog No. 89-942-891 Supplier Abnova™ Supplier No. H00001950Q01S

Description

Used for AP, Array, ELISA, WB-Re

Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. [provided by RefSeq]

Sequence: NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA

Specifications

• Accession Number: NP_001954
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 1950
• Molecular Weight (g/mol): 36.74kDa
• Name: EGF (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: HOMG4/URG
• Common Name: EGF
• Gene Symbol: EGF
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid