Abnova™ Human EIF2C1 Partial ORF (NP_036331, 101 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-943-014	10 μg
89-943-015	25 μg

Catalog No. 89-943-014 Supplier Abnova™ Supplier No. H00026523Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and argonaute 4. [provided by RefSeq]

Sequence: VTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGF

Specifications

• Accession Number: NP_036331
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 26523
• Molecular Weight (g/mol): 36.74kDa
• Name: EIF2C1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: VTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGF
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: AGO1/DKFZp686M13167/EIF2C/GERP95/Q99
• Common Name: EIF2C1
• Gene Symbol: EIF2C1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid