Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human EPPB9 Full-length ORF (AAH02944.1, 1 a.a. - 153 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human EPPB9 Full-length ORF (AAH02944.1, 1 a.a. - 153 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89943485 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-943-485 25 μg
89-943-484 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-943-485 Supplier Abnova™ Supplier No. H00027077P01L
Add to Cart
Add to Cart

Description

Used for AP, Array, ELISA, WB-Re

The B9 protein function is not known. Identification of a conserved mouse homolog and representation in the EST database indicates that this transcript does represent a gene. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq]

Sequence: MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSLCLVASSDLQAAPPTEDK

Specifications

Accession Number AAH02944.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 27077
Molecular Weight (g/mol) 43.3kDa
Name EPPB9 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias B9/EPPB9
Common Name B9D1
Gene Symbol B9D1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.